PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000559.1_g00009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NF-YB
Protein Properties Length: 115aa    MW: 13213.9 Da    PI: 5.2992
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000559.1_g00009.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB152.39.1e-48496395
                    NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90
                             e++++lPianv+rimk++lP++akisk+ake +qe +sefisfvt+easdkc++e+rkt+ngdd++wal++lG+++y+e+++ yl+k+
  Itr_sc000559.1_g00009.1  4 EHEKLLPIANVGRIMKQILPEKAKISKEAKERMQESASEFISFVTCEASDKCHKENRKTVNGDDIVWALSSLGLDNYAEAMTRYLHKF 91
                             7899************************************************************************************ PP

                    NF-YB 91 releg 95
                             re e 
  Itr_sc000559.1_g00009.1 92 REYEM 96
                             **985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.9E-444110IPR009072Histone-fold
SuperFamilySSF471134.66E-356106IPR009072Histone-fold
PfamPF008085.7E-25972IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.7E-173654No hitNo description
PRINTSPR006151.7E-175573No hitNo description
PRINTSPR006151.7E-177492No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 115 aa     Download sequence    Send to blast
MGDEHEKLLP IANVGRIMKQ ILPEKAKISK EAKERMQESA SEFISFVTCE ASDKCHKENR  60
KTVNGDDIVW ALSSLGLDNY AEAMTRYLHK FREYEMLRAS QTRGPAGEED ETDRY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B5e-39493392Transcription factor HapC (Eurofung)
4g92_B5e-39493392Transcription factor HapC (Eurofung)
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00133DAPTransfer from AT1G09030Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009605488.11e-55PREDICTED: nuclear transcription factor Y subunit B-4-like
RefseqXP_009760265.11e-55PREDICTED: nuclear transcription factor Y subunit B-4-like
RefseqXP_016458099.11e-55PREDICTED: nuclear transcription factor Y subunit B-4-like
RefseqXP_016460750.11e-55PREDICTED: nuclear transcription factor Y subunit B-4-like
SwissprotO040274e-53NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
TrEMBLK4B0W92e-54K4B0W9_SOLLC; Uncharacterized protein
STRINGSolyc01g099320.2.16e-54(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09030.12e-54nuclear factor Y, subunit B4